Showing Protein Similar to 6-phosphogluconate dehydrogenase (BMDBP00998)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00998 |
| Secondary Accession Numbers | None |
| Name | Similar to 6-phosphogluconate dehydrogenase |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Carbohydrate transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 16 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 129 |
| Molecular Weight | 14521.0 |
| Theoretical pI | 7.18 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Similar to 6-phosphogluconate dehydrogenase LWRHRPDVEGGLHHQECIPGKDKRCVDRNPGLQNLLLDDFFKSAVENCQDSWRRAISTGV QAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG SVSSSSYNA |
| External Links | |
| GenBank ID Protein | BAC56480.1 |
| UniProtKB/Swiss-Prot ID | Q862J6 |
| UniProtKB/Swiss-Prot Entry Name | Q862J6_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB098990 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |